Structure of PDB 4hmv Chain B

Receptor sequence

>4hmvB (length=206) Species: 294 (Pseudomonas fluorescens)

ESLTGTLDAPFPEYQTLPADPMSVLHNWLERARRVGIREPRALALATADS
QGRPSTRIVVISEISDAGVVFSTHAGSQKGRELLHNPWASGVLYWRETSQ
QIILNGQAVRLPNAKADDAWLKRPYATHPMSSVSRQSEELQDVQAMRNAA
RQLAELQGPLPRPEGYCVFELRLESLEFWGNGQERLHERLRYDRSDTGWN
VRRLQP

3D structure

• PDB: 4hmv Trapped intermediates in crystals of the FMN-dependent oxidase PhzG provide insight into the final steps of phenazine biosynthesis
• Chain: B
• Resolution: 1.45 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R201
• Catalytic site (residue number reindexed from 1): R185
• Enzyme Commision number: 1.10.3.16: dihydrophenazinedicarboxylate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	B	Y110 Q117 W195 R205	Y94 Q101 W179 R189
BS02	FMN	B	R73 I74 V75 V76 S88 T89 S93 Q94 K95 Q152 S153	R57 I58 V59 V60 S72 T73 S77 Q78 K79 Q136 S137

Gene Ontology

Molecular Function

• GO:0004733 pyridoxamine phosphate oxidase activity
• GO:0010181 FMN binding
• GO:0016491 oxidoreductase activity
• GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors

Biological Process

• GO:0002047 phenazine biosynthetic process
• GO:0008615 pyridoxine biosynthetic process
• GO:0017000 antibiotic biosynthetic process
• GO:0042816 vitamin B6 metabolic process
• GO:0042823 pyridoxal phosphate biosynthetic process
• GO:1901615 organic hydroxy compound metabolic process

External links

• PDB: RCSB:4hmv, PDBe:4hmv, PDBj:4hmv
• PDBsum: 4hmv
• PubMed: 23897464
• UniProt: Q51793|PHZG_PSEFL Dihydrophenazinedicarboxylate synthase (Gene Name=phzG)