Structure of PDB 4hiq Chain B

Receptor sequence

>4hiqB (length=115) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVITN

3D structure

• PDB: 4hiq AG10 inhibits amyloidogenesis and cellular toxicity of the familial amyloid cardiomyopathy-associated V122I transthyretin.
• Chain: B
• Resolution: 1.18 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	16V	B	K15 L17 A108 L110 S117 V121	K6 L8 A99 L101 S108 V112	MOAD: Kd=6.2nM PDBbind-CN: -logKd/Ki=8.21,Kd=6.2nM BindingDB: Kd=4.8nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4hiq, PDBe:4hiq, PDBj:4hiq
• PDBsum: 4hiq
• PubMed: 23716704
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)