Structure of PDB 4hf2 Chain B

Receptor sequence
>4hf2B (length=121) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLAQLFSRLR
KNGLVSSVRGPGGGYLLGKDASSIAVGEVISAVDGGDKALTHALWRDLSD
RLTGFLNNITLGELVNNQEVL
3D structure
PDB4hf2 Studies of IscR reveal a unique mechanism for metal-dependent regulation of DNA binding specificity.
ChainB
Resolution2.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B P27 L28 R50 S57 P61 G63 G64 Y65 P27 L28 R50 S57 P61 G63 G64 Y65 PDBbind-CN: Kd=22nM
BS02 dna B R2 S38 S40 Y41 Q44 R59 G60 P61 R2 S38 S40 Y41 Q44 R59 G60 P61 PDBbind-CN: Kd=22nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005506 iron ion binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0051537 2 iron, 2 sulfur cluster binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4hf2, PDBe:4hf2, PDBj:4hf2
PDBsum4hf2
PubMed23644595
UniProtP0AGK8|ISCR_ECOLI HTH-type transcriptional regulator IscR (Gene Name=iscR)

[Back to BioLiP]