Structure of PDB 4hc7 Chain B

Receptor sequence

>4hc7B (length=97) Species: 9606 (Homo sapiens)

HMGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKGTSCA
NCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRN

3D structure

• PDB: 4hc7 DNA Binding by GATA Transcription Factor Suggests Mechanisms of DNA Looping and Long-Range Gene Regulation.
• Chain: B
• Resolution: 2.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	N286 R299 R330 R331 K347 R365 N366	N28 R41 R61 R62 K78 R96 N97
BS02	dna	B	L274 R276 R277 Y283 K293 N340 L344 Y345 H349 R353 M357 Q363 T364 R365	L16 R18 R19 Y25 K35 N71 L75 Y76 H80 R84 M88 Q94 T95 R96
BS03	ZN	B	C318 C321 C339 C342	C49 C52 C70 C73
BS04	ZN	B	C264 C267 C285 C288	C6 C9 C27 C30

Gene Ontology

Molecular Function

• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006357 regulation of transcription by RNA polymerase II

External links

• PDB: RCSB:4hc7, PDBe:4hc7, PDBj:4hc7
• PDBsum: 4hc7
• PubMed: 23142663
• UniProt: P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 (Gene Name=GATA3)