Structure of PDB 4h5g Chain B

Receptor sequence

>4h5gB (length=240) Species: 637987 (Streptococcus pneumoniae str. Canada MDR_19A)

QSAVEAIKQKGKLVVATSPDYAPFEFQSLVDGKNQVVGADIDMAQAIADE
LGVKLEILSMSFDNVLTSLQTGKADLAVAGISATDERKEVFDFSIPYYEN
KISFLVHKADVEKYKDLTSLESANIAAQKGTVPESMVKEQLPKAQLTSLT
NMGEAVNELQAGKIDAVHMDEPVALSYAAKNAGLAVATVSLKMKDGDANA
VALRKNSDDLKEVVDKVIQKLKDEGTYQSYLEKAASLTEV

3D structure

• PDB: 4h5g Crystal structure of an amino acid ABC transporter substrate-binding protein from Streptococcus pneumoniae Canada MDR_19A bound to L-arginine, form 2
• Chain: B
• Resolution: 1.78 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ARG	B	S47 D49 Y50 F91 A108 G109 I110 S111 R116 Q157 T160 D199	S18 D20 Y21 F62 A79 G80 I81 S82 R87 Q128 T131 D170

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 05:45:38 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4h5g', asym_id = 'B', title = 'Crystal structure of an amino acid ABC transport...oniae Canada MDR_19A bound to L-arginine, form 2 '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4h5g', asym_id='B', title='Crystal structure of an amino acid ABC transport...oniae Canada MDR_19A bound to L-arginine, form 2 ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0015276,0016020', uniprot = '', pdbid = '4h5g', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015276,0016020', uniprot='', pdbid='4h5g', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>