Structure of PDB 4h44 Chain B

Receptor sequence

>4h44B (length=160) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418)

MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFAC
IVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLA
MASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALP
LDKSLTLGLF

3D structure

• PDB: 4h44 Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
• Chain: B
• Resolution: 2.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E78
• Catalytic site (residue number reindexed from 1): E78

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	D35 V39 C50 L57	D35 V39 C50 L57
BS02	HEM	B	V39 F40	V39 F40
BS03	CLA	B	V84 M101 L108 V132 F133 G136 V139 T140	V84 M101 L108 V132 F133 G136 V139 T140

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4h44, PDBe:4h44, PDBj:4h44
• PDBsum: 4h44
• PubMed: 23440205
• UniProt: Q93SX1|PETD_NOSS1 Cytochrome b6-f complex subunit 4 (Gene Name=petD)