Structure of PDB 4h2v Chain B

Receptor sequence

>4h2vB (length=297) Species: 224911 (Bradyrhizobium diazoefficiens USDA 110)

ADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALR
FPPVMSRAQLEKSGYLKSFPNLLGCVCGLHGTEREINAAVSRFDAGGDWT
TSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKHL
DRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDP
FFGRVGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWG
IQDANGEPAHTGCVAFGMDRLAVAMFHTHGTDLSAWPAKVRDILGLQ

3D structure

• PDB: 4h2v Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation.
• Chain: B
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C131 R159 E161 R168 E176 K235 A250 S253 C279 R286
• Catalytic site (residue number reindexed from 1): C115 R143 E145 R152 E160 K219 A234 S237 C263 R270
• Enzyme Commision number: 6.2.1.n2: amino acid--[acyl-carrier-protein] ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C131 E176 C279	C115 E160 C263
BS02	AMP	B	R159 E161 L169 F172 M174 K235 A250 C251 S253 G283 R286	R143 E145 L153 F156 M158 K219 A234 C235 S237 G267 R270
BS03	PNS	B	Y132 F217 Q232 N255 H257	Y116 F201 Q216 N239 H241

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004812 aminoacyl-tRNA ligase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006418 tRNA aminoacylation for protein translation

External links

• PDB: RCSB:4h2v, PDBe:4h2v, PDBj:4h2v
• PDBsum: 4h2v
• PubMed: 23541895
• UniProt: Q89VT8|AACL1_BRADU Amino acid--[acyl-carrier-protein] ligase 1 (Gene Name=bll0957)