Structure of PDB 4h2h Chain B

Receptor sequence

>4h2hB (length=367) Species: 314265 (Salipiger bermudensis HTCC2601)

LKIAEIQLFQHDLPVVNGPYRIASGDVWSLTTTIVKIIAEDGTIGWGETC
PVGPTYAEAHAGGALAALEVLASGLAGAEALPLPLHTRMDSLLCGHNYAK
SALDIAVHDLWGKRLGVPVHELLGGALTDSVSSYYSLGVMEPDEAARQAL
EKQREGYSRLQVKLGARPIEIDIEAIRKVWEAVRGTGIALAADGNRGWTT
RDALRFSRECPDIPFVMEQPCNSFEDLEAIRPLCHHALYMDEDGTSLNTV
ITAAATSLVDGFGMKVSRIGGLQHMRAFRDFCAARNLPHTCDDAWGGDIV
SAACTHIASTVLPRLMEGAWLAQPYVAEHYDAENGVRIEGGRIRVPQGPG
LGLTIDPERFGPPLFSA

3D structure

• PDB: 4h2h Discovery of new enzymes and metabolic pathways by using structure and genome context.
• Chain: B
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y20 S136 Q161 K163 D193 E218 D241 E242 K265 D292 D293 A294 E317 G318 A319 W320
• Catalytic site (residue number reindexed from 1): Y20 S136 Q161 K163 D193 E218 D241 E242 K265 D292 D293 A294 E317 G318 A319 W320
• Enzyme Commision number: 5.1.1.22: 4-hydroxyproline betaine 2-epimerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	B	D193 E218 D241	D193 E218 D241
BS02	0XW	B	Y20 Y56 S136 Q161 K163 D241 K265 A294 W320	Y20 Y56 S136 Q161 K163 D241 K265 A294 W320

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0016853 isomerase activity
• GO:0016854 racemase and epimerase activity
• GO:0016855 racemase and epimerase activity, acting on amino acids and derivatives
• GO:0036361 racemase activity, acting on amino acids and derivatives
• GO:0046872 metal ion binding

Biological Process

• GO:0006579 amino-acid betaine catabolic process

External links

• PDB: RCSB:4h2h, PDBe:4h2h, PDBj:4h2h
• PDBsum: 4h2h
• PubMed: 24056934
• UniProt: Q0FPQ4|HPBD_SALBH 4-hydroxyproline betaine 2-epimerase (Gene Name=hpbD)