Structure of PDB 4gzf Chain B |
>4gzfB (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGI GGFVKVRQYDQVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF |
|
PDB | 4gzf Ligand modifications to reduce the relative resistance of multi-drug resistant HIV-1 protease. |
Chain | B |
Resolution | 2.05 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
N25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
N25 T26 G27 |
Enzyme Commision number |
? |
|
|
|
|