Structure of PDB 4gye Chain B

Receptor sequence

>4gyeB (length=99) Species: 11676 (Human immunodeficiency virus 1)

PQITLWKRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGI
GGFVKVRQYDQVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF

3D structure

• PDB: 4gye Ligand modifications to reduce the relative resistance of multi-drug resistant HIV-1 protease.
• Chain: B
• Resolution: 2.27 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N25 T26 G27
• Catalytic site (residue number reindexed from 1): N25 T26 G27

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	N25 G27 A28 D29 D30 K45 I47 G48 P81 T82	N25 G27 A28 D29 D30 K45 I47 G48 P81 T82

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:4gye, PDBe:4gye, PDBj:4gye
• PDBsum: 4gye
• PubMed: 24128815
• UniProt: Q9QM22