Structure of PDB 4gok Chain B

Receptor sequence

>4gokB (length=157) Species: 10090 (Mus musculus)

LRLLMLGLDNAGKTTILKKFTISPTLGFNIKTLEHRGFKLNIWDVGGLKS
LRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLI
FANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWL
LDDISSR

3D structure

• PDB: 4gok Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
• Chain: B
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GNP	B	D25 N26 G28 K29 T30 T31 T47 G69 N125 K126 D128 L129 S158 A159	D9 N10 G12 K13 T14 T15 T25 G47 N103 K104 D106 L107 S136 A137
BS02	MG	B	T30 T47 D66	T14 T25 D44

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0019003 GDP binding

Biological Process

• GO:0006110 regulation of glycolytic process
• GO:0007098 centrosome cycle
• GO:0010811 positive regulation of cell-substrate adhesion
• GO:0031113 regulation of microtubule polymerization
• GO:0031116 positive regulation of microtubule polymerization
• GO:0034260 negative regulation of GTPase activity
• GO:0051457 maintenance of protein location in nucleus
• GO:0070830 bicellular tight junction assembly
• GO:1903715 regulation of aerobic respiration

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space
• GO:0005794 Golgi apparatus
• GO:0005813 centrosome
• GO:0005829 cytosol
• GO:0005856 cytoskeleton
• GO:0005925 focal adhesion
• GO:0016328 lateral plasma membrane

External links

• PDB: RCSB:4gok, PDBe:4gok, PDBj:4gok
• PDBsum: 4gok
• PubMed: 22960633
• UniProt: Q9D0J4|ARL2_MOUSE ADP-ribosylation factor-like protein 2 (Gene Name=Arl2)