Structure of PDB 4gn8 Chain B

Receptor sequence
>4gn8B (length=297) Species: 10090 (Mus musculus) [Search protein sequence]
SIKVECVLRENYRCGESPVWEEASQSLLFVDIPSKIICRWDTVSNQVQRV
AVDAPVSSVALRQLGGYVATIGTKFCALNWENQSVFVLAMVDEDKKNNRF
NDGKVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPDHSVKKYFDQVDI
SNGLDWSLDHKIFYYIDSLSYTVDAFDYDLQTGQISNRRIVYKMEKDEQI
PDGMCIDAEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGG
KDYSEMYVTCARDGLNAEGLLRQPDAGNIFKITGLGVKGIAPYSYAG
3D structure
PDB4gn8 Structural basis of the gamma-lactone-ring formation in ascorbic acid biosynthesis by the senescence marker protein-30/gluconolactonase
ChainB
Resolution1.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.1.17: gluconolactonase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CA B E18 N154 D204 E16 N152 D202
BS02 ASO B G67 N81 W82 E83 G65 N79 W80 E81
BS03 ASO B R101 N103 E121 N154 D204 R99 N101 E119 N152 D202
BS04 ASO B A125 R129 A123 R127
BS05 ASO B Y166 A177 R191 P229 Y164 A175 R189 P227
BS06 ASO B P229 E230 T231 G232 P227 E228 T229 G230
Gene Ontology
Molecular Function
GO:0004341 gluconolactonase activity
GO:0005509 calcium ion binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0030234 enzyme regulator activity
GO:0046872 metal ion binding
Biological Process
GO:0001822 kidney development
GO:0001889 liver development
GO:0006874 intracellular calcium ion homeostasis
GO:0007283 spermatogenesis
GO:0010867 positive regulation of triglyceride biosynthetic process
GO:0010907 positive regulation of glucose metabolic process
GO:0019853 L-ascorbic acid biosynthetic process
GO:0032781 positive regulation of ATP-dependent activity
GO:0043066 negative regulation of apoptotic process
GO:0045019 negative regulation of nitric oxide biosynthetic process
GO:0045723 positive regulation of fatty acid biosynthetic process
GO:0050680 negative regulation of epithelial cell proliferation
GO:0050848 regulation of calcium-mediated signaling
GO:0097421 liver regeneration
GO:1901318 negative regulation of flagellated sperm motility
GO:1902679 negative regulation of RNA biosynthetic process
GO:1903011 negative regulation of bone development
GO:1903052 positive regulation of proteolysis involved in protein catabolic process
GO:1903625 negative regulation of DNA catabolic process
GO:2000279 negative regulation of DNA biosynthetic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4gn8, PDBe:4gn8, PDBj:4gn8
PDBsum4gn8
PubMed23349732
UniProtQ64374|RGN_MOUSE Regucalcin (Gene Name=Rgn)

[Back to BioLiP]