Structure of PDB 4gej Chain B |
>4gejB (length=136) Species: 9606 (Homo sapiens) [Search protein sequence] |
KSFEVVFNDPEKVYGSGERVAGRVIVEVSEVTRVKAVRILASGVAKVLWM QGSQQCKQTSEYLRYEDTLLLEDEMVIMRPGNKYEYKFGFELPQGPLGTS FKGKYGSVDYWVKAFLDRPSQPTQETKKNFEVVDLV |
|
PDB | 4gej Structure of the N-terminal domain of human thioredoxin-interacting protein. |
Chain | B |
Resolution | 2.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
D74 T75 |
D67 T68 |
|
|
|