Structure of PDB 4gcm Chain B

Receptor sequence

>4gcmB (length=309) Species: 196620 (Staphylococcus aureus subsp. aureus MW2)

TEIDFDIAIIGAGPAGMTAAVYASRANLKTVMIERGIPGGQMANTEEVEN
FPGFEMITGPDLSTKMFEHAKKFGAVYQYGDIKSVEDKGEYKVINFGNKE
LTAKAVIIATGAEYKKIGVPGEQELGGRGVSYCAVCDGAFFKNKRLFVIG
GGDSAVEEGTFLTKFADKVTIVHRRDELRAQRILQDRAFKNDKIDFIWSH
TLKSINEKDGKVGSVTLTSTKDGSEETHEADGVFIYIGMKPLTAPFKDLG
ITNDVGYIVTKDDMTTSVPGIFAAGDVRDKGLRQIVTATGDGSIAAQSAA
EYIEHLNDQ

3D structure

• PDB: 4gcm Crystal structure of a thioredoxine reductase (trxB) from Staphylococcus aureus subsp. aureus Mu50 at 1.80 A resolution
• Chain: B
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C134 C137 D138
• Catalytic site (residue number reindexed from 1): C133 C136 D137
• Enzyme Commision number: 1.8.1.9: thioredoxin-disulfide reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	G12 G14 P15 A16 E35 R36 G41 Q42 T46 N51 D82 I83 T111 G112 C137 G276 D277 Q285 I286	G11 G13 P14 A15 E34 R35 G40 Q41 T45 N50 D81 I82 T110 G111 C136 G275 D276 Q284 I285
BS02	NAP	B	I118 G152 G153 D154 S155 E158 R175 R176 R180 Q182 I238	I117 G151 G152 D153 S154 E157 R174 R175 R179 Q181 I237

Gene Ontology

Molecular Function

• GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
• GO:0016491 oxidoreductase activity

Biological Process

• GO:0019430 removal of superoxide radicals
• GO:0045454 cell redox homeostasis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4gcm, PDBe:4gcm, PDBj:4gcm
• PDBsum: 4gcm
• UniProt: P66011|TRXB_STAAW Thioredoxin reductase (Gene Name=trxB)