Structure of PDB 4g8r Chain B

Receptor sequence
>4g8rB (length=368) Species: 9606 (Homo sapiens) [Search protein sequence]
APSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGE
TQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDL
KLVQGFMPHFFRLFRSTVKQVDFSEVERARFIINDWVKTHTKGMISHLLG
TGAVDQLTRLVLVNALYFNGQWKTPFPDSSTHRRLFHKSDGSTVSVPMMA
QTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNI
LSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQ
ADFTSLSDQEPLHVALALQKVKIEVNESAVIVSARMAPEEIIIDRPFLFV
VRHNPTGTVLFMGQVMEP
3D structure
PDB4g8r Mechanistic characterization and crystal structure of a small molecule inactivator bound to plasminogen activator inhibitor-1.
ChainB
Resolution2.19 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 96P B S6 Y7 H10 S3 Y4 H7 MOAD: Kd=22nM
PDBbind-CN: -logKd/Ki=7.66,Kd=22nM
BS02 96P B S41 M45 L75 R76 Y79 F117 R118 S38 M42 L72 R73 Y76 F114 R115 MOAD: Kd=22nM
PDBbind-CN: -logKd/Ki=7.66,Kd=22nM
Gene Ontology
Molecular Function
GO:0002020 protease binding
GO:0004867 serine-type endopeptidase inhibitor activity
GO:0005102 signaling receptor binding
GO:0005515 protein binding
Biological Process
GO:0001525 angiogenesis
GO:0010466 negative regulation of peptidase activity
GO:0010469 regulation of signaling receptor activity
GO:0010757 negative regulation of plasminogen activation
GO:0010951 negative regulation of endopeptidase activity
GO:0014912 negative regulation of smooth muscle cell migration
GO:0030194 positive regulation of blood coagulation
GO:0030195 negative regulation of blood coagulation
GO:0030336 negative regulation of cell migration
GO:0032757 positive regulation of interleukin-8 production
GO:0033629 negative regulation of cell adhesion mediated by integrin
GO:0035491 positive regulation of leukotriene production involved in inflammatory response
GO:0042730 fibrinolysis
GO:0045766 positive regulation of angiogenesis
GO:0048260 positive regulation of receptor-mediated endocytosis
GO:0050729 positive regulation of inflammatory response
GO:0050829 defense response to Gram-negative bacterium
GO:0051918 negative regulation of fibrinolysis
GO:0061044 negative regulation of vascular wound healing
GO:0061045 negative regulation of wound healing
GO:0071222 cellular response to lipopolysaccharide
GO:0090026 positive regulation of monocyte chemotaxis
GO:0090399 replicative senescence
GO:0097187 dentinogenesis
GO:1901331 positive regulation of odontoblast differentiation
GO:1902042 negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:2000098 negative regulation of smooth muscle cell-matrix adhesion
GO:2000352 negative regulation of endothelial cell apoptotic process
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005886 plasma membrane
GO:0031093 platelet alpha granule lumen
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:0097180 serine protease inhibitor complex
GO:1904090 peptidase inhibitor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4g8r, PDBe:4g8r, PDBj:4g8r
PDBsum4g8r
PubMed24297881
UniProtP05121|PAI1_HUMAN Plasminogen activator inhibitor 1 (Gene Name=SERPINE1)

[Back to BioLiP]