Structure of PDB 4g5s Chain B

Receptor sequence
>4g5sB (length=316) Species: 9606 (Homo sapiens) [Search protein sequence]
KEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSI
IAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLW
RDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKT
TGIVETHFTFKDLYFKMFDVGGSERKKWIHCFEGVTAIIFCVALSDYDLV
LAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPL
TICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQ
FVFDAVTDVIIKNNLK
3D structure
PDB4g5s Crystal Structures of LGN-GoLoco/Galphai Complexes Reveal the General Mode of GoLoco/Galphai Interaction with a Double Arg-finger GDP Coordination
ChainB
Resolution3.62 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E43 T48 R178 D200
Catalytic site (residue number reindexed from 1) E12 T17 R147 D169
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019001 guanyl nucleotide binding
GO:0019003 GDP binding
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0046872 metal ion binding
Biological Process
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007194 negative regulation of adenylate cyclase activity
GO:0007212 G protein-coupled dopamine receptor signaling pathway
GO:0016239 positive regulation of macroautophagy
GO:0046039 GTP metabolic process
GO:0051301 cell division
Cellular Component
GO:0000139 Golgi membrane
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005765 lysosomal membrane
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005834 heterotrimeric G-protein complex
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030496 midbody
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4g5s, PDBe:4g5s, PDBj:4g5s
PDBsum4g5s
PubMed
UniProtP08754|GNAI3_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-3 (Gene Name=GNAI3)

[Back to BioLiP]