Structure of PDB 4g2s Chain B |
>4g2sB (length=106) Species: 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) [Search protein sequence] |
PYIVRLLNSSLNGCEFPLLTGRTLFVVGQSDALTASGQLPDIPADSFFIP LDHGGVNFEIQVDTDATEIILHELKEGNSESRSVQLNTPIQVGELLILIR PESEPW |
|
PDB | 4g2s A Refined Model of the Prototypical Salmonella SPI-1 T3SS Basal Body Reveals the Molecular Basis for Its Assembly. |
Chain | B |
Resolution | 1.858 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
D76 D78 T80 |
D63 D65 T67 |
|
|
|
|