Structure of PDB 4fyy Chain B

Receptor sequence

>4fyyB (length=147) Species: 83333 (Escherichia coli K-12)

LQVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLNLPSGEMGRK
DLIKIENTFLSEDQVDQLALYAPQATVNRIDNYEVVGKSRPSLPERIDNV
LVCPNSNCISHAEPVSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN

3D structure

• PDB: 4fyy Metal Ion Involvement in the Allosteric Mechanism of Escherichia coli Aspartate Transcarbamoylase.
• Chain: B
• Resolution: 1.9395 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C109 C114 C138 C141	C103 C108 C132 C135
BS02	UTP	B	L7 Q8 V9 H20 P49 S50 G51 E52 K56 L58 K60	L1 Q2 V3 H14 P43 S44 G45 E46 K50 L52 K54
BS03	CTP	B	A11 I12 V17 D19 H20 K60 N84 I86 Y89 V91 K94	A5 I6 V11 D13 H14 K54 N78 I80 Y83 V85 K88

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
• GO:0006221 pyrimidine nucleotide biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0009347 aspartate carbamoyltransferase complex

External links

• PDB: RCSB:4fyy, PDBe:4fyy, PDBj:4fyy
• PDBsum: 4fyy
• PubMed: 22906065
• UniProt: P0A7F3|PYRI_ECOLI Aspartate carbamoyltransferase regulatory chain (Gene Name=pyrI)