Structure of PDB 4ft8 Chain B

Receptor sequence
>4ft8B (length=200) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEG
KEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLI
QVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDA
MTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
3D structure
PDB4ft8 Structure of catabolite activator protein with cobalt(II) and sulfate.
ChainB
Resolution1.966 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CMP B V49 I70 G71 E72 L73 R82 S83 A84 R123 T127 V43 I64 G65 E66 L67 R76 S77 A78 R117 T121
BS02 SO4 B D68 Q119 R122 R123 D62 Q113 R116 R117
BS03 SO4 B K57 C178 S179 T182 K51 C172 S173 T176
BS04 SO4 B T168 R169 Q170 R180 T162 R163 Q164 R174
BS05 CO B H19 H21 E96 H13 H15 E90
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003680 minor groove of adenine-thymine-rich DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0008301 DNA binding, bending
GO:0030552 cAMP binding
GO:0042802 identical protein binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045013 carbon catabolite repression of transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ft8, PDBe:4ft8, PDBj:4ft8
PDBsum4ft8
PubMed24817710
UniProtP0ACJ8|CRP_ECOLI DNA-binding transcriptional dual regulator CRP (Gene Name=crp)

[Back to BioLiP]