Structure of PDB 4fni Chain B

Receptor sequence

>4fniB (length=110) Species: 158879 (Staphylococcus aureus subsp. aureus N315)

AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDT
DEVKILTIWESEDSFNNYLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVF
KYDIGYHYQK

3D structure

• PDB: 4fni Inactivation of the heme degrading enzyme IsdI by an active site substitution that diminishes heme ruffling.
• Chain: B
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 1.14.99.48: heme oxygenase (staphylobilin-producing).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	N6 R21 F22 R25 Q26 I28 F63 Y66 F72 H76 V79 N95	N8 R23 F24 R27 Q28 I30 F65 Y68 F74 H78 V81 N97

Gene Ontology

Molecular Function

• GO:0004392 heme oxygenase (decyclizing) activity
• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0033212 iron import into cell
• GO:0042167 heme catabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4fni, PDBe:4fni, PDBj:4fni
• PDBsum: 4fni
• PubMed: 22891243
• UniProt: Q7A827|HDOX2_STAAN Heme oxygenase (staphylobilin-producing) 2 (Gene Name=isdI)