Structure of PDB 4fgz Chain B

Receptor sequence

>4fgzB (length=258) Species: 5833 (Plasmodium falciparum)

SDKTFLENNQYTDEGVKVYEFIFGENYISSGGLEATKKILSDIELNENSK
VLDIGSGLGGGCMYINEKYGAHTHGIDICSNIVNMANERVSGNNKIIFEA
NDILTKEFPENNFDLIYSRDAILHLSLENKNKLFQKCYKWLKPTGTLLIT
DYCATEKENWDDEFKEYVKQRKYTLITVEEYADILTACNFKNVVSKDLSD
YWNQLLEVEHKYLHENKEEFLKLFSEKKFISLDDGWSRKIKDSKRKMQRW
GYFKATKN

3D structure

• PDB: 4fgz Crystal structure of phosphoethanolamine methyltransferase from Plasmodium falciparum in complex with amodiaquine.
• Chain: B
• Resolution: 1.994 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.103: phosphoethanolamine N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CQA	B	I30 F31 G32 G39 E42 L213 V216 E217 Y220	I22 F23 G24 G31 E34 L205 V208 E209 Y212	MOAD: ic50=1350uM BindingDB: IC50=1350000nM
BS02	CQA	B	E171 E174 Y175 G243 R246 K247	E163 E166 Y167 G235 R238 K239	MOAD: ic50=1350uM BindingDB: IC50=1350000nM
BS03	SAH	B	Y19 I36 S37 G63 D85 I86 I111 R127 A129 H132	Y11 I28 S29 G55 D77 I78 I103 R119 A121 H124

Gene Ontology

Molecular Function

• GO:0000234 phosphoethanolamine N-methyltransferase activity
• GO:0008168 methyltransferase activity

Biological Process

• GO:0006656 phosphatidylcholine biosynthetic process
• GO:0008654 phospholipid biosynthetic process
• GO:0009058 biosynthetic process
• GO:0032259 methylation

Cellular Component

• GO:0000139 Golgi membrane
• GO:0005737 cytoplasm
• GO:0005794 Golgi apparatus
• GO:0016020 membrane

External links

• PDB: RCSB:4fgz, PDBe:4fgz, PDBj:4fgz
• PDBsum: 4fgz
• PubMed: 22771008
• UniProt: Q8IDQ9|PMT_PLAF7 Phosphoethanolamine N-methyltransferase (Gene Name=PMT)