Structure of PDB 4fc7 Chain B

Receptor sequence

>4fc7B (length=276) Species: 9606 (Homo sapiens)

QPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHG
CHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALK
EFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKF
FRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIR
VNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYL
ASPLASYVTGAVLVADGGAWLTFPNG

3D structure

• PDB: 4fc7 Studies of human 2,4-dienoyl CoA reductase shed new light on peroxisomal beta-oxidation of unsaturated fatty acids
• Chain: B
• Resolution: 1.84 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G39 A165 Q175 H177 A178 K182
• Catalytic site (residue number reindexed from 1): G37 A163 Q173 H175 A176 K180
• Enzyme Commision number: 1.3.1.124: 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing].

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	B	S38 G39 I40 S59 R60 S61 R64 D86 V87 C113 A114 A115 I163 K182 P208 G209 T214 G216	S36 G37 I38 S57 R58 S59 R62 D84 V85 C111 A112 A113 I161 K180 P206 G207 T212 G214
BS02	COA	B	R60 G116 N117 F118 S126 N128 A129 T132 R219	R58 G114 N115 F116 S124 N126 A127 T130 R217

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008670 2,4-dienoyl-CoA reductase (NADPH) activity
• GO:0016491 oxidoreductase activity
• GO:0019166 trans-2-enoyl-CoA reductase (NADPH) activity

Biological Process

• GO:0006631 fatty acid metabolic process
• GO:0006636 unsaturated fatty acid biosynthetic process
• GO:0009062 fatty acid catabolic process
• GO:0033540 fatty acid beta-oxidation using acyl-CoA oxidase

Cellular Component

• GO:0005777 peroxisome
• GO:0005778 peroxisomal membrane
• GO:0005829 cytosol

External links

• PDB: RCSB:4fc7, PDBe:4fc7, PDBj:4fc7
• PDBsum: 4fc7
• PubMed: 22745130
• UniProt: Q9NUI1|DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] (Gene Name=DECR2)