Structure of PDB 4f48 Chain B |
>4f48B (length=97) Species: 340 (Xanthomonas campestris pv. campestris) [Search protein sequence] |
QGILSLALKDKAALYSAYMPFVKSGGIFVPTPKRYMLGDEVFLLLTLPDS SERLPVAGKVVWTTPAGANRAAGIGVQFPDGPEGEAVRNKIETLLAG |
|
PDB | 4f48 Structural polymorphism of c-di-GMP bound to an EAL domain and in complex with a type II PilZ-domain protein. |
Chain | B |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
C2E |
B |
G45 E47 K66 |
G38 E40 K59 |
|
|
|
|