Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 4f2w Chain B

Receptor sequence

>4f2wB (length=237) Species: 904139 (Salmonella enterica subsp. enterica serovar Choleraesuis str. SCSA50)

LVPRGSHMKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEV
ALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSD
ETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRG
LIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVR
AISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLA

3D structure

• PDB: 4f2w Crystal structure of 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Salmonella enterica with methyl-thio-DADMe-Immucillin-A
• Chain: B
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TDI	B	I50 S76 A77 G78 F151 I152 E172 M173 E174 D197 F207	I57 S83 A84 G85 F158 I159 E179 M180 E181 D204 F214	MOAD: Ki=5pM PDBbind-CN: -logKd/Ki=11.30,Ki=5.0pM
BS02	EDO	B	H0 K2 D69	H7 K9 D76
BS03	EDO	B	G154 S155 D200 Q201	G161 S162 D207 Q208

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue May 13 12:51:02 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1709                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1710         else:

=> 1711             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1712     

   1713     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4f2w', asym_id = 'B', title = "Crystal structure of 5'-methylthioadenosine/S-ad...lla enterica with methyl-thio-DADMe-Immucillin-A "

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4f2w', asym_id='B', title="Crystal structure of 5'-methylthioadenosine/S-ad...lla enterica with methyl-thio-DADMe-Immucillin-A ")

    843 

    844     if go:

=>  845         display_go(go,uniprot,pdbid,asym_id)

    846     return pubmed,uniprot

    847 

global display_go = <function display_go>, go = '0003824,0008782,0008930,0009116,0009164,0019509', uniprot = '', pdbid = '4f2w', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003824,0008782,0008930,0009116,0009164,0019509', uniprot='', pdbid='4f2w', asym_id='B')

    484         '''.replace("$namespace_link",namespace_link

    485           ).replace("$namespace",namespace

=>  486           ).replace("$uniprot",u

    487         ))

    488         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>