Structure of PDB 4ex0 Chain B

Receptor sequence
>4ex0B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
3D structure
PDB4ex0 Structural meta-analysis of regular human insulin in pharmaceutical formulations.
ChainB
Resolution1.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28 T30 F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28 T30
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4ex0, PDBe:4ex0, PDBj:4ex0
PDBsum4ex0
PubMed23692694
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]