Structure of PDB 4en2 Chain B

Receptor sequence
>4en2B (length=149) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence]
SKSSVIGWPAVRERMRRAEPAEEVGFPVTPQVPLRPMTYKAAVDLSHFLK
EKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTFGWC
YKLVPVEPDKVEEANKGENDPEREVLEWRFDSRLAFHHVARELHPEYFK
3D structure
PDB4en2 Structural basis of evasion of cellular adaptive immunity by HIV-1 Nef.
ChainB
Resolution2.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide B Q73 P75 P78 M79 T80 T138 F203 Q31 P33 P36 M37 T38 T96 F148
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0017124 SH3 domain binding
GO:0019901 protein kinase binding
GO:0031996 thioesterase binding
GO:0042288 MHC class I protein binding
GO:0042609 CD4 receptor binding
GO:0051117 ATPase binding
Biological Process
GO:0006915 apoptotic process
GO:0019049 virus-mediated perturbation of host defense response
GO:0019058 viral life cycle
GO:0033668 symbiont-mediated suppression of host apoptosis
GO:0039505 symbiont-mediated suppression of host antigen processing and presentation of peptide antigen via MHC class II
GO:0039521 suppression by virus of host autophagy
GO:0045225 negative regulation of CD4 production
GO:0046776 symbiont-mediated suppression of host antigen processing and presentation of peptide antigen via MHC class I
GO:0050848 regulation of calcium-mediated signaling
GO:0070206 protein trimerization
GO:0075528 perturbation by virus of host immune response
Cellular Component
GO:0005576 extracellular region
GO:0016020 membrane
GO:0020002 host cell plasma membrane
GO:0044177 host cell Golgi apparatus
GO:0044178 host cell Golgi membrane
GO:0044423 virion component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4en2, PDBe:4en2, PDBj:4en2
PDBsum4en2
PubMed22705789
UniProtQ90VU7

[Back to BioLiP]