Structure of PDB 4emz Chain B

Receptor sequence

>4emzB (length=138) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence]

WSKSSVIGWPAVRERMRRAEAQEEEEVGFPVTPQVPLRPMTYKAAVDLSH
FLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTF
GWCYKLVPVEPREVLEWRFDSRLAFHHVARELHPEYFK

3D structure

PDB

4emz Structural basis of evasion of cellular adaptive immunity by HIV-1 Nef.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	Q73 V74 P75 M79 T138 F203	Q34 V35 P36 M40 T99 F137

Gene Ontology

	Biological Process
GO:0006915	apoptotic process
GO:0019049	virus-mediated perturbation of host defense response
GO:0019058	viral life cycle
GO:0033668	symbiont-mediated suppression of host apoptosis
GO:0039505	symbiont-mediated suppression of host antigen processing and presentation of peptide antigen via MHC class II
GO:0039521	suppression by virus of host autophagy
GO:0045225	negative regulation of CD4 production
GO:0046776	symbiont-mediated suppression of host antigen processing and presentation of peptide antigen via MHC class I
GO:0050848	regulation of calcium-mediated signaling
GO:0070206	protein trimerization
GO:0075528	perturbation by virus of host immune response

External links