Structure of PDB 4ekn Chain B

Receptor sequence

>4eknB (length=304) Species: 243232 (Methanocaldococcus jannaschii DSM 2661)

MKHLISMKDIGKEEILEILDEARKMEELLNTKRPLKLLEGKILATVFYEP
STRTRLSFETAMKRLGGEVITMTDLKSSSVAKGESLIDTIRVISGYADII
VLRHPSEGAARLASEYSQVPIINAGDGSNQHPTQTLLDLYTIMREIGRID
GIKIAFVGDLKYGRTVHSLVYALSLFENVEMYFVSPKELRLPKDIIEDLK
AKNIKFYEKESLDDLDDDIDVLYVTRIQKERFPDPNEYEKVKGSYKIKRE
YVEGKKFIIMHPLPRVDEIDYDVDDLPQAKYFKQSFYGIPVRMAILKKLI
EDNE

3D structure

• PDB: 4ekn Structure of the catalytic chain of Methanococcus jannaschii aspartate transcarbamoylase in a hexagonal crystal form: insights into the path of carbamoyl phosphate to the active site of the enzyme.
• Chain: B
• Resolution: 2.4996 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): T225 P262 G288
• Catalytic site (residue number reindexed from 1): T225 P262 G288
• Enzyme Commision number: 2.1.3.2: aspartate carbamoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SO4	B	G163 R164 T165 R226	G163 R164 T165 R226

Gene Ontology

Molecular Function

• GO:0004070 aspartate carbamoyltransferase activity
• GO:0004088 carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
• GO:0016597 amino acid binding
• GO:0016740 transferase activity
• GO:0016743 carboxyl- or carbamoyltransferase activity

Biological Process

• GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0006520 amino acid metabolic process
• GO:0006541 glutamine metabolic process
• GO:0044205 'de novo' UMP biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4ekn, PDBe:4ekn, PDBj:4ekn
• PDBsum: 4ekn
• PubMed: 22691781
• UniProt: Q58976|PYRB_METJA Aspartate carbamoyltransferase catalytic subunit (Gene Name=pyrB)