Structure of PDB 4egs Chain B

Receptor sequence

>4egsB (length=147) Species: 273068 (Caldanaerobacter subterraneus subsp. tengcongensis MB4)

SMRVLFVCTGNTCRSPMAEGIFNAKSKALGKDWEAKSAGVFAPEGFPASS
EAVEVLKKEYGIDISDHRAKSLREEDLKGADLVLAMAFSHKRSLVSQYPE
YADKIFTIKEFVGLEGDVEDPYGMPLEVYKKTAEELSGLIDKLIEKL

3D structure

• PDB: 4egs Crystal Structure Analysis of Low Molecular Weight Protein Tyrosine Phosphatase from T. tengcongensis
• Chain: B
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C7 T8 G9 N10 T11 C12 R13 S14 S36 R67 K69 A86 L93 D119
• Catalytic site (residue number reindexed from 1): C8 T9 G10 N11 T12 C13 R14 S15 S37 R68 K70 A87 L94 D120

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCT	B	C7 T8 G9 N10 T11 C12 R13	C8 T9 G10 N11 T12 C13 R14

Gene Ontology

Molecular Function

• GO:0004725 protein tyrosine phosphatase activity

Biological Process

• GO:0006470 protein dephosphorylation

External links

• PDB: RCSB:4egs, PDBe:4egs, PDBj:4egs
• PDBsum: 4egs
• UniProt: Q8RD95