Structure of PDB 4e5f Chain B

Receptor sequence

>4e5fB (length=180) Species: 284218 (Influenza A virus (A/Viet Nam/1203/2004(H5N1)))

MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD
GGSKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIE
IGVTRREVHTYYLEKANKIKSEETHIHIFSFTGEEMATKADYTLDEESRA
RIKTRLFTIRQEMASRGLWDSFRQSERAAA

3D structure

• PDB: 4e5f Structural and Biochemical Basis for Development of Influenza Virus Inhibitors Targeting the PA Endonuclease.
• Chain: B
• Resolution: 2.392 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	B	H41 D108 E119 I120	H41 D89 E100 I101
BS02	MN	B	E80 P107 D108	E61 P88 D89
BS03	0N7	B	H41 E80 D108 K134	H41 E61 D89 K115	MOAD: ic50=15uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:4e5f, PDBe:4e5f, PDBj:4e5f
• PDBsum: 4e5f
• PubMed: 22876176
• UniProt: Q5EP34