Structure of PDB 4e1v Chain B

Receptor sequence

>4e1vB (length=244) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)

KSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTS
WRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHI
NVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTH
VGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATL
LTMCASQGLRAGMVAGVIVNRTQQEIPNESHAVKIVVEAARRLL

3D structure

• PDB: 4e1v X-ray structure of Salmonella typhimurium uridine phosphorylase complexed with 5-fluorouracil and molecular modelling of the complex of 5-fluorouracil with uridine phosphorylase from Vibrio cholerae.
• Chain: B
• Resolution: 2.15 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H1008 G1026 R1030 R1048 E1080 R1091 T1094 R1168 I1220 V1221 R1223
• Catalytic site (residue number reindexed from 1): H6 G24 R28 R46 E78 R89 T92 R166 I218 V219 R221
• Enzyme Commision number: 2.4.2.3: uridine phosphorylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	URF	B	T1095 G1096 Q1166 R1168 I1220 V1221	T93 G94 Q164 R166 I218 V219

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004850 uridine phosphorylase activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity
• GO:0047847 deoxyuridine phosphorylase activity

Biological Process

• GO:0009116 nucleoside metabolic process
• GO:0009164 nucleoside catabolic process
• GO:0009166 nucleotide catabolic process
• GO:0044206 UMP salvage

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4e1v, PDBe:4e1v, PDBj:4e1v
• PDBsum: 4e1v
• PubMed: 22868762
• UniProt: P0A1F6|UDP_SALTY Uridine phosphorylase (Gene Name=udp)