Structure of PDB 4dbq Chain B

Receptor sequence
>4dbqB (length=148) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQD
MINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFI
SAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
3D structure
PDB4dbq Mutations in myosin VI that cause a loss of coordination between heads provide insights into the structural changes underlying force generation and the importance of gating
ChainB
Resolution2.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) V35
Catalytic site (residue number reindexed from 1) V35
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA B D20 D22 D24 T26 E31 D20 D22 D24 T26 E31
BS02 CA B D56 D58 N60 T62 I63 E67 D56 D58 N60 T62 I63 E67
BS03 CA B D93 D95 N97 F99 E104 D93 D95 N97 F99 E104
BS04 CA B D129 D131 D133 Q135 E140 D129 D131 D133 Q135 E140
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0016247 channel regulator activity
GO:0030234 enzyme regulator activity
GO:0031489 myosin V binding
GO:0032036 myosin heavy chain binding
GO:0046872 metal ion binding
GO:0070855 myosin VI head/neck binding
Biological Process
GO:0007099 centriole replication
GO:0007605 sensory perception of sound
GO:0007608 sensory perception of smell
GO:0016056 G protein-coupled opsin signaling pathway
GO:0016059 negative regulation of opsin-mediated signaling pathway
GO:0016060 negative regulation of phospholipase C-activating phototransduction signaling pathway
GO:0030048 actin filament-based movement
GO:0042052 rhabdomere development
GO:0046716 muscle cell cellular homeostasis
GO:0048102 autophagic cell death
GO:0050911 detection of chemical stimulus involved in sensory perception of smell
GO:0051383 kinetochore organization
GO:0071361 cellular response to ethanol
GO:0072499 photoreceptor cell axon guidance
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005814 centriole
GO:0005819 spindle
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005938 cell cortex
GO:0016028 rhabdomere
GO:0030496 midbody
GO:0031475 myosin V complex
GO:0031476 myosin VI complex
GO:0031477 myosin VII complex
GO:0072686 mitotic spindle
GO:0097431 mitotic spindle pole

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4dbq, PDBe:4dbq, PDBj:4dbq
PDBsum4dbq
PubMed
UniProtP62152|CALM_DROME Calmodulin (Gene Name=Cam)

[Back to BioLiP]