Structure of PDB 4day Chain B

Receptor sequence
>4dayB (length=113) Species: 9606 (Homo sapiens) [Search protein sequence]
AGVRLPRSPPLKVLAEQLRRDAAVWMQGRVVMADRGEARLRDPSGDFSVR
GLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESM
WELEVEDLHRNIP
3D structure
PDB4day Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
ChainB
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B V15 R16 L17 P18 V120 K121 V3 R4 L5 P6 V86 K87
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0006260 DNA replication
GO:0006281 DNA repair
GO:0033045 regulation of sister chromatid segregation
GO:0043007 maintenance of rDNA
GO:0071139 resolution of DNA recombination intermediates
GO:2000042 negative regulation of double-strand break repair via homologous recombination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005829 cytosol
GO:0016607 nuclear speck
GO:0031422 RecQ family helicase-topoisomerase III complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4day, PDBe:4day, PDBj:4day
PDBsum4day
PubMed22392978
UniProtQ96E14|RMI2_HUMAN RecQ-mediated genome instability protein 2 (Gene Name=RMI2)

[Back to BioLiP]