Structure of PDB 4d8v Chain B

Receptor sequence

>4d8vB (length=231) Species: 1423 (Bacillus subtilis)

SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGT
YKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVR
DVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVG
SVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTV
SDHVLTGEETTAEERQTTFHDMIDVALHSVS

3D structure

• PDB: 4d8v Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
• Chain: B
• Resolution: 2.35 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H4 G20 R24 R43 E75 R87 S90 S202 D203 V205 R216
• Catalytic site (residue number reindexed from 1): H3 G19 R23 R42 E74 R86 S89 S201 D202 V204 R215
• Enzyme Commision number: 2.4.2.1: purine-nucleoside phosphorylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADE	B	G92 F159 V177	G91 F158 V176

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004731 purine-nucleoside phosphorylase activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity

Biological Process

• GO:0006139 nucleobase-containing compound metabolic process
• GO:0006152 purine nucleoside catabolic process
• GO:0009116 nucleoside metabolic process
• GO:0009164 nucleoside catabolic process
• GO:0042278 purine nucleoside metabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4d8v, PDBe:4d8v, PDBj:4d8v
• PDBsum: 4d8v
• PubMed: 22957058
• UniProt: O34925|DEOD_BACSU Purine nucleoside phosphorylase DeoD-type (Gene Name=deoD)