Structure of PDB 4d7z Chain B

Receptor sequence

>4d7zB (length=95) Species: 562 (Escherichia coli) [Search protein sequence]

cCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVQGA
AAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAK

3D structure

PDB

4d7z The Structure of the E. Coli L-Aspartate-Alpha-Decarboxylase Mutant N72Q to a Resolution of 1.9 Angstroms

Chain

Resolution

1.9 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

Enzymatic activity

Catalytic site (original residue number in PDB)	Y58
Catalytic site (residue number reindexed from 1)	Y33
Enzyme Commision number	4.1.1.11: aspartate 1-decarboxylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	F32 A36 G37 I68 I69 S70 V71 Q72 G73 A76 H77 S80 V81 G82 D83 I84 V85 I86 I87 A88 S89 F90 V91 T92 M93 D95 A98 R99 W101 P103 N104 V105 A106 Y107 F108 D111 N112	F8 A12 G13 I44 I45 S46 V47 Q48 G49 A52 H53 S56 V57 G58 D59 I60 V61 I62 I63 A64 S65 F66 V67 T68 M69 D71 A74 R75 W77 P79 N80 V81 A82 Y83 F84 D87 N88

Gene Ontology

	Molecular Function
GO:0004068	aspartate 1-decarboxylase activity

	Biological Process
GO:0006523	alanine biosynthetic process

External links

PDB	RCSB:4d7z, PDBe:4d7z, PDBj:4d7z
PDBsum	4d7z
PubMed
UniProt	P0A790\|PAND_ECOLI Aspartate 1-decarboxylase (Gene Name=panD)