Structure of PDB 4d40 Chain B |
>4d40B (length=89) Species: 211586 (Shewanella oneidensis MR-1) [Search protein sequence] |
GKQGRRFDAQQYLVTSAQALERHYSRNGLYPASQSLANSPYYSFSYTPTA DKFGFSLKAVPTNRQSDPCGTLSLDHKGVRVPATNCWSH |
|
PDB | 4d40 High-Resolution Structure of a Type Iv Pilin from the Metal- Reducing Bacterium Shewanella Oneidensis. |
Chain | B |
Resolution | 1.669 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NA |
B |
L36 N38 F44 |
L36 N38 F44 |
|
|
|
|