Structure of PDB 4cyu Chain B

Receptor sequence
>4cyuB (length=155) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPTEQPN
FLNLCVEIQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGE
EMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDS
VKRYK
3D structure
PDB4cyu Structure-Based Design and Development of Functionalized Mercaptoguanine Derivatives as Inhibitors of the Folate Biosynthesis Pathway Enzyme 6-Hydroxymethyl-7,8-Dihydropterin Pyrophosphokinase from Staphylococcus Aureus.
ChainB
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG B E78 D95 V96 D97 E75 D92 V93 D94
BS02 MG B D95 D97 D92 D94
BS03 APC B L71 R92 D95 D97 I98 K110 L111 S112 L68 R89 D92 D94 I95 K107 L108 S109
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue May 6 12:55:02 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1471                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1472         else:
=> 1473             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1474     
   1475     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4cyu', asym_id = 'B', title = 'Structure-Based Design and Development of Functi...in Pyrophosphokinase from Staphylococcus Aureus. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4cyu', asym_id='B', title='Structure-Based Design and Development of Functi...in Pyrophosphokinase from Staphylococcus Aureus. ')
    840 
    841     if go:
=>  842         display_go(go,uniprot,pdbid,asym_id)
    843     return pubmed,uniprot
    844 
global display_go = <function display_go>, go = '0003848,0009396', uniprot = '', pdbid = '4cyu', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003848,0009396', uniprot='', pdbid='4cyu', asym_id='B')
    481         '''.replace("$namespace_link",namespace_link
    482           ).replace("$namespace",namespace
=>  483           ).replace("$uniprot",u
    484         ))
    485         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>