Structure of PDB 4crz Chain B

Receptor sequence
>4crzB (length=128) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MKLTIIRLEKFSDQDRIDLQKIWPEYSPSSLQVDDNHRIYAARFNERLLA
AVRVTLSGTEGALDSLRVREVTRRRGVGQYLLEEVLRNNPGVSCWWMADA
GVEDRGVMTAFMQALGFTAQQGGWEKCS
3D structure
PDB4crz The Structure of the Pand/Panz Protein Complex Reveals Negative Feedback Regulation of Pantothenate Biosynthesis by Coenzyme A.
ChainB
Resolution1.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ACO B W23 E25 Y26 S65 L66 R67 V68 R73 R74 G76 G78 Q79 E103 F111 W23 E25 Y26 S65 L66 R67 V68 R73 R74 G76 G78 Q79 E103 F111 MOAD: Kd=35nM
BS02 MG B T72 R73 R74 R75 G76 V77 T72 R73 R74 R75 G76 V77
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
GO:1905502 acetyl-CoA binding
Biological Process
GO:0015940 pantothenate biosynthetic process
GO:0016485 protein processing
GO:0031638 zymogen activation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4crz, PDBe:4crz, PDBj:4crz
PDBsum4crz
PubMed25910242
UniProtP37613|PANZ_ECOLI PanD regulatory factor (Gene Name=panZ)

[Back to BioLiP]