Structure of PDB 4chg Chain B

Receptor sequence
>4chgB (length=133) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
AMIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTD
EDTAALRRRLLQRFAIEPLAPVRDAEDAAAIHRRCRRGGDTVRSLIDCQV
AAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
3D structure
PDB4chg Crystal Structure of the Vapbc-15 Complex from Mycobacterium Tuberculosis Reveals a Two-Metal Ion Dependent Pin-Domain Ribonuclease And a Variable Mode of Toxin-Antitoxin Assembly.
ChainB
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B R85 R92 R86 R93
BS02 peptide B S6 I9 Y11 L12 S13 S20 A24 D30 E42 I45 G46 K47 L55 R56 R58 L59 R62 S93 D96 D114 S7 I10 Y12 L13 S14 S21 A25 D31 E43 I46 G47 K48 L56 R57 R59 L60 R63 S94 D97 D115
BS03 MN B D96 D114 D116 D97 D115 D117
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004518 nuclease activity
GO:0004540 RNA nuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0001666 response to hypoxia
GO:0045926 negative regulation of growth

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4chg, PDBe:4chg, PDBj:4chg
PDBsum4chg
PubMed25450593
UniProtP9WF97|VPC15_MYCTU Ribonuclease VapC15 (Gene Name=vapC15)

[Back to BioLiP]