Structure of PDB 4cas Chain B

Receptor sequence

>4casB (length=273) Species: 1079 (Blastochloris viridis) [Search protein sequence]

ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIG
YAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISW
MLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGI
LSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANP
GDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIA
SGPFWTRGWPEWWGWWLDIPFWS

3D structure

PDB

4cas Structure of a photosynthetic reaction centre determined by serial femtosecond crystallography.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	B	M174 V177 F181 M185	M174 V177 F181 M185
BS02	BCL	B	F97 P124 M127 F128 V157 F160 W167 H168 H173 S176 V177 F241 G244 T248	F97 P124 M127 F128 V157 F160 W167 H168 H173 S176 V177 F241 G244 T248
BS03	BCL	B	F146 I150 H153 L154 V157	F146 I150 H153 L154 V157
BS04	BPB	B	I42 I49 A93 W100 E104 A120 F121 P124 Y148 G149 I150 H153 F241	I42 I49 A93 W100 E104 A120 F121 P124 Y148 G149 I150 H153 F241
BS05	MPG	B	W115 L119 S238	W115 L119 S238
BS06	MPG	B	H190 F216 I229	H190 F216 I229
BS07	FE2	B	H190 H230	H190 H230
BS08	BPB	B	F181 M185 L189	F181 M185 L189
BS09	MQ7	B	Y29 I39 R103	Y29 I39 R103
BS10	OTP	B	F62 L151	F62 L151

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4cas, PDBe:4cas, PDBj:4cas
PDBsum	4cas
PubMed	24352554
UniProt	P06009\|RCEL_BLAVI Reaction center protein L chain (Gene Name=pufL)

[Back to BioLiP]