Structure of PDB 4c9l Chain B

Receptor sequence

>4c9lB (length=407) Species: 48935 (Novosphingobium aromaticivorans)

KHRVAPPPHVPGHLIREIDAYDLDGLEQGFHEAWKRVQQPDTPPLVWTPF
TGGHWIATRGTLIDEIYRSPERFSSRVIWVPREAGEAYDMVPTKLDPPEH
TPYRKAIDKGLNLAEIRKLEDQIRTIAVEIIEGFADRGHCEFGSEFSTVF
PVRVFLALAGLPVEDATKLGLLANEMTRPSGNTPEEQGRSLEAANKGFFE
YVAPIIAARRGGSGTDLITRILNVEIDGKPMPDDRALGLVSLLLLGGLDT
VVNFLGFMMIYLSRHPETVAEMRREPLKLQRGVEELFRRFAVVSDARYVV
SDMEFHGTMLKEGDLILLPTALHGLDDRHHDDPMTVDLSRRDVTHSTFAQ
GPHRCAGMHLARLEVTVMLQEWLARIPEFRLKDRAVPIYHSGIVAAVENI
PLEWEPQ

3D structure

• PDB: 4c9l Crystal Structures and Functional Characterization of Wild Type and Active Sites Mutants of Cyp101D1.
• Chain: B
• Resolution: 1.801 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R188 G256 D259 T260 V261 C365 A366 G367 E374 V404
• Catalytic site (residue number reindexed from 1): R178 G246 D249 T250 V251 C355 A356 G357 E364 V394

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	P102 T103 H110 R114 G256 T260 V261 V303 D305 R307 T357 F358 A359 H363 C365 G367	P92 T93 H100 R104 G246 T250 V251 V293 D295 R297 T347 F348 A349 H353 C355 G357
BS02	CAM	B	W89 Y98	W79 Y88

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:4c9l, PDBe:4c9l, PDBj:4c9l
• PDBsum: 4c9l
• PubMed: 24261604
• UniProt: Q2GB12