Structure of PDB 4c2s Chain B

Receptor sequence

>4c2sB (length=290) Species: 9606 (Homo sapiens)

VSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQN
TTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQLAAVPRVT
LGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVD
MEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDF
YYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRH
KPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRN

3D structure

• PDB: 4c2s Structural and Biochemical Characterization of the Human Blood Group a and B Galactosyltransferases Posessing the Pro156Leu Mutation
• Chain: B
• Resolution: 2.48 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H233 L266 W300 E303 A343 R352
• Catalytic site (residue number reindexed from 1): H170 L203 W237 E240 A280 R289
• Enzyme Commision number: 2.4.1.37: fucosylgalactoside 3-alpha-galactosyltransferase.
  2.4.1.40: glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DLG	B	H233 F236 T245 Y264 W300 E303	H170 F173 T182 Y201 W237 E240
BS02	FUC	B	D326 H348	D263 H285
BS03	MN	B	D211 D213	D148 D150
BS04	UDP	B	F121 A122 I123 Y126 V184 R188 D211 V212 D213 K346 R352	F58 A59 I60 Y63 V121 R125 D148 V149 D150 K283 R289

Gene Ontology

Molecular Function

• GO:0016758 hexosyltransferase activity

Biological Process

• GO:0005975 carbohydrate metabolic process

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:4c2s, PDBe:4c2s, PDBj:4c2s
• PDBsum: 4c2s
• UniProt: P16442|BGAT_HUMAN Histo-blood group ABO system transferase (Gene Name=ABO)