Structure of PDB 4bzi Chain B

Receptor sequence

>4bziB (length=164) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

HGKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTF
DLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAEL
KDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGIEGQRPVEVFMCSVVM
RNGYLEAFQWLSQY

3D structure

PDB

4bzi The Structure of the Copii Transport-Vesicle Coat Assembled on Membranes

Chain

Resolution

23.0 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H77
Catalytic site (residue number reindexed from 1)	H55
Enzyme Commision number	3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GNP	B	D32 N33 G35 K36 T37 T38 P53 T54 G76 N132 K133 D135 S172 V173 V174	D10 N11 G13 K14 T15 T16 P31 T32 G54 N110 K111 D113 S147 V148 V149
BS02	MG	B	T37 T54	T15 T32

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity

	Biological Process
GO:0000266	mitochondrial fission
GO:0003400	regulation of COPII vesicle coating
GO:0006886	intracellular protein transport
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006998	nuclear envelope organization
GO:0007006	mitochondrial membrane organization
GO:0015031	protein transport
GO:0016050	vesicle organization
GO:0016192	vesicle-mediated transport
GO:0061024	membrane organization
GO:0070863	positive regulation of protein exit from endoplasmic reticulum
GO:1902953	positive regulation of ER to Golgi vesicle-mediated transport

	Cellular Component
GO:0000139	Golgi membrane
GO:0005739	mitochondrion
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005794	Golgi apparatus
GO:0012507	ER to Golgi transport vesicle membrane
GO:0016020	membrane
GO:0030127	COPII vesicle coat
GO:0031410	cytoplasmic vesicle
GO:0044233	mitochondria-associated endoplasmic reticulum membrane contact site
GO:0070971	endoplasmic reticulum exit site

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4bzi, PDBe:4bzi, PDBj:4bzi
PDBsum	4bzi
PubMed	24062940
UniProt	P20606\|SAR1_YEAST Small COPII coat GTPase SAR1 (Gene Name=SAR1)

[Back to BioLiP]