Structure of PDB 4b1x Chain B

Receptor sequence

>4b1xB (length=357) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

TTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRSYVGDEAQSKRGILTLK
YPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEG
YALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCY
VALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIG
MESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEIT
ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPS
IVHRKCF

3D structure

PDB

4b1x Structures of the Phactr1 RPEL domain and RPEL motif complexes with G-actin reveal the molecular basis for actin binding cooperativity.

Chain

Resolution

1.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	L110 Y143 G146 T148 E167 G168 Y169 P172 H173 I175 I345 L349 T351 F375	L92 Y125 G128 T130 E149 G150 Y151 P154 H155 I157 I327 L331 T333 F357
BS02	LAB	B	G15 Q59 Y69 D157 R183 T186 R206 E207 R210	G11 Q41 Y51 D139 R165 T168 R188 E189 R192	BindingDB: IC50=8470nM
BS03	ATP	B	G13 S14 G15 L16 K18 G156 D157 G158 V159 G182 R210 K213 E214 G301 G302 M305 Y306 K336	G9 S10 G11 L12 K14 G138 D139 G140 V141 G164 R192 K195 E196 G283 G284 M287 Y288 K318

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003785	actin monomer binding
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005523	tropomyosin binding
GO:0005524	ATP binding
GO:0016787	hydrolase activity
GO:0019904	protein domain specific binding
GO:0031013	troponin I binding
GO:0031432	titin binding
GO:0032036	myosin heavy chain binding
GO:0042802	identical protein binding
GO:0048306	calcium-dependent protein binding
GO:0140660	cytoskeletal motor activator activity

	Biological Process
GO:0010628	positive regulation of gene expression
GO:0030041	actin filament polymerization
GO:0030240	skeletal muscle thin filament assembly
GO:0048741	skeletal muscle fiber development
GO:0051017	actin filament bundle assembly
GO:0090131	mesenchyme migration

	Cellular Component
GO:0001725	stress fiber
GO:0005737	cytoplasm
GO:0005856	cytoskeleton
GO:0005865	striated muscle thin filament
GO:0005884	actin filament
GO:0030027	lamellipodium
GO:0030175	filopodium
GO:0031941	filamentous actin
GO:0032432	actin filament bundle
GO:0044297	cell body
GO:0098723	skeletal muscle myofibril

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4b1x, PDBe:4b1x, PDBj:4b1x
PDBsum	4b1x
PubMed	23041370
UniProt	P68135\|ACTS_RABIT Actin, alpha skeletal muscle (Gene Name=ACTA1)

[Back to BioLiP]