Structure of PDB 4b1w Chain B

Receptor sequence

>4b1wB (length=361) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

TALVCDNGSGLVKAGFAGDDAPRAVFPSIVARPRHQKDSYVGDEAQSKRG
ILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPK
ANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNV
PIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIK
EKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQ
PSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRM
QKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYD
EAGPSIVHRKC

3D structure

PDB

4b1w Structures of the Phactr1 RPEL domain and RPEL motif complexes with G-actin reveal the molecular basis for actin binding cooperativity.

Chain

Resolution

1.95 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	Y143 T148 Y166 E167 G168 Y169	Y130 T135 Y153 E154 G155 Y156
BS02	LAB	B	G15 P32 Q59 Y69 D157 R183 T186 R206 E207 R210	G10 P27 Q46 Y56 D144 R170 T173 R193 E194 R197	BindingDB: IC50=8470nM
BS03	ATP	B	G13 S14 G15 L16 K18 G156 D157 G158 V159 R210 K213 E214 G301 G302 M305 Y306 K336	G8 S9 G10 L11 K13 G143 D144 G145 V146 R197 K200 E201 G288 G289 M292 Y293 K323

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003785	actin monomer binding
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005523	tropomyosin binding
GO:0005524	ATP binding
GO:0016787	hydrolase activity
GO:0019904	protein domain specific binding
GO:0031013	troponin I binding
GO:0031432	titin binding
GO:0032036	myosin heavy chain binding
GO:0042802	identical protein binding
GO:0048306	calcium-dependent protein binding
GO:0140660	cytoskeletal motor activator activity

	Biological Process
GO:0010628	positive regulation of gene expression
GO:0030041	actin filament polymerization
GO:0030240	skeletal muscle thin filament assembly
GO:0048741	skeletal muscle fiber development
GO:0051017	actin filament bundle assembly
GO:0090131	mesenchyme migration

	Cellular Component
GO:0001725	stress fiber
GO:0005737	cytoplasm
GO:0005856	cytoskeleton
GO:0005865	striated muscle thin filament
GO:0005884	actin filament
GO:0030027	lamellipodium
GO:0030175	filopodium
GO:0031941	filamentous actin
GO:0032432	actin filament bundle
GO:0044297	cell body
GO:0098723	skeletal muscle myofibril

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4b1w, PDBe:4b1w, PDBj:4b1w
PDBsum	4b1w
PubMed	23041370
UniProt	P68135\|ACTS_RABIT Actin, alpha skeletal muscle (Gene Name=ACTA1)

[Back to BioLiP]