Structure of PDB 4b1u Chain B

Receptor sequence
>4b1uB (length=349) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
TTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGSYVGDEAQSKRGILTLKY
PIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKM
TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGY
ALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYV
ALDFENEMATEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHE
TTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMK
IKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF
3D structure
PDB4b1u Structures of the Phactr1 RPEL domain and RPEL motif complexes with G-actin reveal the molecular basis for actin binding cooperativity.
ChainB
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 LAB B G15 P32 Q59 Y69 D157 R183 T186 R206 E207 R210 G11 P28 Q40 Y50 D138 R164 T167 R187 E188 R191
BS02 ATP B G13 S14 G15 L16 K18 G156 D157 G158 G182 R210 K213 E214 G302 M305 Y306 K336 G9 S10 G11 L12 K14 G137 D138 G139 G163 R191 K194 E195 G276 M279 Y280 K310
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
Biological Process
GO:0009612 response to mechanical stimulus
GO:0010628 positive regulation of gene expression
GO:0030240 skeletal muscle thin filament assembly
GO:0035865 cellular response to potassium ion
GO:0043503 skeletal muscle fiber adaptation
GO:0048545 response to steroid hormone
GO:0048741 skeletal muscle fiber development
GO:0090131 mesenchyme migration
Cellular Component
GO:0001725 stress fiber
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005865 striated muscle thin filament
GO:0005884 actin filament
GO:0015629 actin cytoskeleton
GO:0030017 sarcomere
GO:0030027 lamellipodium
GO:0030175 filopodium
GO:0032991 protein-containing complex
GO:0044297 cell body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4b1u, PDBe:4b1u, PDBj:4b1u
PDBsum4b1u
PubMed23041370
UniProtP68134|ACTS_MOUSE Actin, alpha skeletal muscle (Gene Name=Acta1)

[Back to BioLiP]