Structure of PDB 4awl Chain B

Receptor sequence
>4awlB (length=92) Species: 9606 (Homo sapiens) [Search protein sequence]
FREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEA
SERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFRE
3D structure
PDB4awl Sequence-Specific Transcription Factor NF-Y Displays Histone-Like DNA Binding and H2B-Like Ubiquitination.
ChainB
Resolution3.08 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B Q53 K75 I76 A77 K78 Q4 K26 I27 A28 K29
BS02 dna B P58 I59 A60 N61 R64 K75 P9 I10 A11 N12 R15 K26
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4awl, PDBe:4awl, PDBj:4awl
PDBsum4awl
PubMed23332751
UniProtP25208|NFYB_HUMAN Nuclear transcription factor Y subunit beta (Gene Name=NFYB)

[Back to BioLiP]