Structure of PDB 4aqu Chain B

Receptor sequence
>4aquB (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
3D structure
PDB4aqu 5'-Cytosine-Phosphoguanine (Cpg) Methylation Impacts the Activity of Natural and Engineered Meganucleases.
ChainB
Resolution2.3 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G219 D220
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B D220 G221 S222 Q226 K228 Q244 T246 Q247 K248 R270 N336 D337 S338 R341 K342 T343 D19 G20 S21 Q25 K27 Q43 T45 Q46 K47 R69 N135 D136 S137 R140 K141 T142 PDBbind-CN: Kd=40.8nM
BS02 dna B S232 Y233 K234 Q238 R268 R270 E280 I281 K316 D337 K339 T340 S31 Y32 K33 Q37 R67 R69 E79 I80 K115 D136 K138 T139 PDBbind-CN: Kd=40.8nM
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4aqu, PDBe:4aqu, PDBj:4aqu
PDBsum4aqu
PubMed22740697
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]