Structure of PDB 4aqr Chain B

Receptor sequence

>4aqrB (length=141) Species: 3702 (Arabidopsis thaliana)

DQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDM
INEVDADGNGTIDFPEFLNLMARDSEEELKEAFRVFDKDQNGFISAAELR
HVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA

3D structure

• PDB: 4aqr A Bimodular Mechanism of Calcium Control in Eukaryotes
• Chain: B
• Resolution: 1.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): V36
• Catalytic site (residue number reindexed from 1): V34

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	D21 D23 D25 C27 E32	D19 D21 D23 C25 E30
BS02	CA	B	D57 D59 N61 T63 E68	D55 D57 N59 T61 E66
BS03	CA	B	D130 D132 D134 Q136 E141	D123 D125 D127 Q129 E134
BS04	CA	B	D94 D96 N98 F100 E105	D87 D89 N91 F93 E98

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0005513 detection of calcium ion
• GO:0010099 regulation of photomorphogenesis
• GO:0050832 defense response to fungus

Cellular Component

• GO:0005634 nucleus
• GO:0005829 cytosol
• GO:0005886 plasma membrane

External links

• PDB: RCSB:4aqr, PDBe:4aqr, PDBj:4aqr
• PDBsum: 4aqr
• PubMed: 23086147
• UniProt: P59220|CALM7_ARATH Calmodulin-7 (Gene Name=CAM7)