Structure of PDB 4ac9 Chain B

Receptor sequence

>4ac9B (length=456) Species: 39152 (Methanococcus maripaludis)

MDFKNINLGIFGHIDHGKTTLSKVLTEIAKRGITIDIGFSAFKLENYRIT
LVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNI
PIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGV
DELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIV
KVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYR
GCILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVA
VPFKKVTFGKTEENIILNEVISGNECYCAFELEEKVLAEVGDRVLITRLD
LPPTTLRICGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQS
KVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILN
RLRRWG

3D structure

• PDB: 4ac9 Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
• Chain: B
• Resolution: 3.03 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D15 K18 T19 T46 H69
• Catalytic site (residue number reindexed from 1): D15 K18 T19 T34 H57

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	B	I14 D15 G17 K18 T19 T20 K120 D122 S155 A156 K157	I14 D15 G17 K18 T19 T20 K108 D110 S143 A144 K145
BS02	DXC	B	I47 D48 I49 F51 V202 Q233 G249	I35 D36 I37 F39 V190 Q221 G237
BS03	5GP	B	P96 K97 M104 L105 I139 T143 I288 L368	P84 K85 M92 L93 I127 T131 I276 L356

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005525 GTP binding
• GO:0046872 metal ion binding

Biological Process

• GO:0001514 selenocysteine incorporation
• GO:0006414 translational elongation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4ac9, PDBe:4ac9, PDBj:4ac9
• PDBsum: 4ac9
• PubMed: 15616587
• UniProt: Q8J307